Q: Discuss physiological and pathological influences on mobility ?
A: Physiology is known as branch of science in which we study the normal body function of organisms.…
Q: Demonstrate an isotonic contraction. How does it feel? What do you think causes the physical…
A: The tension-generating site activation within the muscle fibers is called muscle contraction. It can…
Q: How does physiology of physical activity fit within the discipline of kinesiology?
A: Kinesiology refers to the study of body movements of the human or nonhuman body. It involves…
Q: the muscle that is "mainly" responsible for a movement is called the? the muscle that acts in…
A: It is a bundle of fibrous tissues produce motion and force in human body and helps in maintaining…
Q: What do you consider to be the most important characteristics of physical activity?
A: Various factors affect the relevance and significance of the physical activity. It is crucial to…
Q: Do you believe the techniques athletes use to train and enhance performance should be regulated? If…
A: There is the use of steroids known as Anabolic steroids, to enhance the performance of athletes…
Q: You are the gym with a friend who complains that she cannot lift as much weight on a new machine as…
A: Exercise refers to any type of physical activity. During exercise, the two important organs of the…
Q: List four unique characteristics of human physical activity.
A: The bodily movement that requires energy expenditure and is brought about by the skeletal muscles of…
Q: List different types of movements? Give some examples?
A: BASIC INFORMATION JOINTS The point of meeting of two bones or more than that is known as joint. The…
Q: How does Physical Activity develop the four aspects of a human? (Aerobic Fitness, Muscular Fitness,…
A: All movement is referred to as physical activity. Walking, cycling, wheeling, sports, active…
Q: Name the three Nobel Prize winners whose research work involved muscle or muscular exercise.
A: Muscles are the soft tissue that has filaments to change its shape and length. The filaments present…
Q: What are some benefits of doing muscular strength one your body
A: Muscles are involved in the movement and locomotion of the body.
Q: How can body mass be accounted for in strength testing?
A: Body Mass Index is about a person's weight in kilograms divided by the square of height in meters. A…
Q: Discuss eight scientifically documented benefits of physical activity.
A: Physical activity and exercise is an important component for pleading a healthy life. Being…
Q: Give 10 example each of high and low impact aerobic movement
A: Aerobic exercise plays a very important role in our fitness and healthy lifestyle. This helps to…
Q: Explain how when driving you control the car's speed by typical negative feedback mechanism?
A: Negative feedback control is the primary mode for homeostasis. This mechanism controls and cancels…
Q: Training increases mechanical efficiency of a sport task which leads to a decrease in the energy…
A: Ans- True Training increases mechanical efficiency of sports task which leads to DECREASE in…
Q: Describe action of different compartments of arm, forearm, thigh and leg muscles. Posterior and…
A: The major muscles of the mammalian leg muscles are: adductor muscle; biceps muscle; gastrocnemius…
Q: What makes a person’s leg more or less stiff during running or hopping? What sort of internal…
A: A stiffer leg spring allows humans to run with a higher stride frequency at the same forward speed.…
Q: What are the advantages and disadvantages in playing Basketball?
A: BASKETBALL- Basketball is a sport in which two teams of five players compete against each other on…
Q: When holding an object, does the number of motor units remain the same? Are the same motor units…
A: Motor unit is made up of a motor neuron and the skeletal muscle fibers innervated by the motor…
Q: A friend who was involved in an accident is wearing a leg cast. Describe the condition that will…
A: The orthopedic devices that are used to protect and support broken or injured bones and joints are…
Q: What methods can you think of that kinesiologists might use to study physical activity?
A: Kinesiology is a type of treatment that utilizations muscle monitoring (biofeedback) to take a look…
Q: using the graph answer these questions Use the above graph of the sagittal ankle angle during…
A: Exercise also aids in the reduction and alleviation of pre-existing health problems. Exercising…
Q: What is body weight exercise
A: Exercise is the performance of certain activities which help in stretching body and muscles and…
Q: Explain the term Rigor Mortis and describe how it occurs
A: A body undergoes complex and intricate changes after death. These postmortem changes depend on a…
Q: How to tell a domestic cat is muscular?
A: The muscular system of the cat is designed for walking, running and twisting. Due the musculature in…
Q: a. Differentiate gymnastics as a sport and as a physical activity. b. Which do you think is easier,…
A: Gymnastics is a sport that includes physical exercises requiring balance, strength, flexibility,…
Q: Why is it important to know the proper way of conducting physical activities and exercises?
A: Physical activities and exercising is meant to be beneficial to health. It can assist people in…
Q: How can strength be measured
A: Physical strength is a function of the exertion of force on physical objects by an entity. The aim…
Q: If someone is showing symptoms of acute mountain sickness, you should Increase aerobic…
A: If someone, has fall in acute mountain sickness, he should move to a lower elevation as quickly and…
Q: Discuss how the following exercises can help the body and explain how to execute each exercises 1.…
A: Here we have discuss how to execute and what are the benefits of reverse crunches, bridge and…
Q: Name the categories of vigorous physical activity and give 1 example for each
A: Metabolic equivalents (METs) are used to measure exercise activity. The energy that is required to…
Q: What is high and low impact aerobic movement? Give 10 example each of high and low impact aerobic…
A: The high/low-impact aerobics Gets you aerobically fit. High/low-impact aerobics categories contain a…
Q: Read and answer the following questions to at least 3 to 5 sentences per item. Why is F.I.T.T…
A: The FITT principles are an exercise prescription to help participants understand how long and how…
Q: Discuss how the following exercises can help the body and explain how to execute each exercises 1.…
A: Exercises are very vital for improving the muscle power and tone. This will strengthen and tone the…
Q: What exercise can you integrate into your regular routine, describe it, where and when can you do…
A: In the modern world people tend to be busy and are unable to give time to healthy activities like…
- DIFFERENTIATE GYMNASTICS AS A SPORT AND AS A PHYSICAL ACTIVITY.
- WHICH DO YOU THINK IS EASIER, PERFORMING WITH THE HEAVY OR LIGHT APPARATUS? WHY?
Step by step
Solved in 2 steps
- HEB Thursday - M M Inbox (158) HAC Home View Su X A web.kamihq.com/web/viewer.html?state=%7B'ids"%3A%5B 1dvxol57h6z004SawaUYeJo4xKCG613q5 %5D%2C'action"%3A'ope HE Course Modules: S A See the source ima. 6 New Tab A Classes HEB Course Modules: 7t. Winter Wonderland hebisd.edu bookmarks tudent Edu O O Camille Ervin - Monster Genetics_page_1.jpg Part 1 Procedure: 1. Flip a coin twice to determine the genotype for each trait and record it in the data table. Heads = allele 1, Tails = allele 2 (Example: if you fipped heads twice, your monster will hove two copies of ollele 1 for his genotype.) 2. Determine the phenotype resulting from the allele pair for each trait. 3. Repeat steps 1-2 for each trait and complete the female monster's Table 1. nary O Speech Table 1: Genotypes & Phenotypes for Female Monster Allele 1 Phenotype Trait Allele 2 Genotype Eye Two small eyes (E) One large eye (e) Eye Color (incomplete) Red (R) White (R') ment Skin Color Green (G) Blue (B) (codominant) Tail Shape 18…https://assignment.itslearning.ce X https://assignment.itslearning.c X .itslearning.com/mvc/Attachment/Get?Fileld=4rMyeCo2mEONWRK2cOFQzL2ygiD3VrOV2Au61%2fOZ%2f5to%2{6NE actice Problems and Homework_Dihybrid Cross Worksheet Dihybrid Practice Problems (1) Saved to itslearning it References Review View Help O Editing A A A 三、=、行 v 12 AaBbCc AaBbCc AaBbCc No Spacing x Aav 2 v A, 三、m、T Normal Heading 1 Paragraph smooth and white? Font Styles Two rough black guinea pigs when bred together have two offspring. One of them is rough white and the other is smooth black. What are the genotypes of these parents? 10. Parent 1 Parent 2Document1 - Word Kosi Okogwu File Home Insert Design Layout References Mailings Review View Help Tell me what you want to do 유 Share % Cut A A := - E - O Find - Aa v AaBbCcC AaBbCcC AaBb AaBbC AaBbCcD AaB AaBbCcD AaBbCcDd AaBbCcDd Calibri -|12 Ee Copy abc Replace Paste U v abe X, X aly v A v 1 Normal 1 No Spac... Heading 1 Heading 2 Heading 3 Title Subtitle Subtle Em. Emphasis V Format Painter A Select v Clipboard Font Paragraph Styles Editing 2) The image in Figure 2 is of the diatom, Fragilariopsis cylindrus. Determine the size (length) of the diatom indicated by the red arrow and determine the magnification used. Show your calculations. 5.0 um Figure 2: Scanning electron micrograph of Fragilariopsis cylindrus cells. Page 2 of 8 1505 words KAccessibility: Investigate 110%
- ule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11charepoint.com/personal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc=(1d4afd6b-61ae-49ad-aaef-b9bd03f8cfa7)&action3De -91 - Saved P Search (Alt + Q) rout References Review View Help O Editing v A A B I A A mC Clever Porta x dng To Do ady G Edote Q2 2021 SCLGB 2 M x A Did you finish your interim? if no X i edcite com/apps/MOElemiewer7assignid-nhaadmin_1611780315611&exid-nhaassessments 1571155631555&acode C6G7L7 2021_SCI_G8 12 MI12465/2 OF 25 Question 2- Notes C Line Guide Reset Answer Use the information below to answer the question. Complete the sentence below to describe the relationship between sunlight and the rubber tree. If sunlight was not an available resource to a rubber tree, this process would The Amazon rainforest is the world's largest rainforest, famous for its vast biodiversity. Rubber trees are one of the many organisms populating the forest. When the bark is peeled back, it reveals a white, milky sap known as latex which can be used for making rubber materials and waterproofing items. They also produce fruits which when dropped burst open upon ripeness to reveal the trees not - take place because it is a necessary component in the reaction. seeds Rubber tree fruit (above)…וןווד ← Q Lab Report 6 worksheets 314 F22 .DOCX File Edit View Insert Format Tools Help A 100% ¿ Summary Grades for Arysta Visser: 23 x M Uh-oh! There's a problem w X b The restriction EcoRI cleaves X + Untitled spreadsheet - Goog X https://docs.google.com/document/d/1mKY1HIgMPRh1kRDCmX7msBF2yf07-ogT/edit Outline Headings you add to the document will appear here. Normal text Times ... 12 + B I U 2 18. The restriction EcoRI cleaves double-stranded DNA at the sequence 5'-GAATTC-3', the restriction enzyme HindIII cleaves at the sequence 5'-AAGCTT-3', and the restriction enzyme BamHI cleaves at 5'GGATCC-3. An 805 bp circular plasmid is digested with each enzyme individually and then in combination, and the resulting fragment sizes are determined by means of electrophoresis. The results are as follows: 1 Restriction Enzyme(s) EcoRI BamHI HindIII EcoRI and BamHI EcoRI and HindIII BamHI and HindIII 3 Practice ====•=•€ EX Fragment lengths (base pairs) 430 bp, 375 bp 470 bp, 335 bp Lab Report 6…A ALEKS - Julianna Graham - Lex ← -> C + www-awu.aleks.com/alekscgi/x/Isl.exe/10_u-lgNslkr7j8P3JH-IQUHIQg6bJxmeSyVPHOEB1plef9xyC5Ca9QIC2eximg3llf4UgzRAfAEs Bjuj6RDc7Yrn0JQE5NIn-2CENI_Mk.... Biological Macromolecules Classifying mutations A certain section of the coding (sense) strand of some DNA looks like this: ATGAGGTTATAG It's known that a very small gene is contained in this section. In the table below, write the base sequence for two point mutations of this DNA, one silent, and one not. Silent mutation: Non-silent mutation: Explanation Check MacBook Air 0/5 Julianna 5 ala 2024 McGraw Hill LLC. All Rights Reserved. Terms of Use Privacy Center | Accessibility ΣBro n-2 1alz ah MB Home Insert Draw Design Layout References Mailings Review Help View St Tahorna 12 A A" Aa - A O Find - AaBbCcl AaBbCcI AaBbC AABBCCC c Replace x A- 2- A- T Normal T No Spac. Heading 1 Heading 2 Dictate Sensitivity Editor A Select pard Font Paragraph Styles 12\ Editing Voice Sensitvity Editor Name: Date: Osmosis and cell membrane A. Use your notes and check the correct box in the chart below: Hypotonic Hypertonic Solution Isotonic STATEMENT Solution Solution 1. The concentration of the solute in the solution is lower than the concentration inside the celI. 2. When a cell is placed in this solution, water will enter the cell by osmosis causing it to swell. 3. The concentration of the solute in the solution is the same as the concentration inside the cell. 4. The concentration of the solute in the solution is higher than the concentration inside the cell. 5. When this solution is injected into the body no cell disruption Occurs because no net osmosis occurs. 6. Putting…W AutoSave Off H 2-0 = brief v File Home Insert Draw X Paste Clipboard Page 2 of 2 23°C Sunny Calibri (Body) I U BIU 867 words m Design Layout 12 A A Aa A D✓ A✓ x² A ab ab x₂ x Font References Mailings Review View Help AL T 5 Search 165-15-16- E = = = ~ Name: Jasmine Cooper MRN: 210735 Gender: Female D.O.B: 02 November 1990 Allergies: NKA Marital Status: Married Paragraph Admitting Doctor: Amelia Ong Aboriginal and Torres Strait Islander: No SITUATION: Jasmine (Jas), 32 years old, was brought into Emergency Department (ED) by ambulance. She called the ambulance after an intentional overdose of her prescribed medications and cutting her left wrist. She smelt heavily of alcohol when she arrived in ED. Jas was drowsy with an unsteady gait but was hemodynamically stable. The ED Psychiatrist reviewed Jas and admitted her involuntarily under the Mental Health Act. She is awaiting medical clearance before transfer to the acute mental health unit. ADMISSION ASSESSMENT: On assessment, Jas was…6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…Hurry! Ite Document2 Document2 x W W Document2 TO Biol3210 /personal/eenongen_my_tnstate_edu/_layouts/15/Doc.aspx?sourcedoc=%7B4fb03944-7062-4106.. O Search (Option + Q) Review View Help Editing v AaBbCc AaBbCc No Spacing AaBbCc AaBbCc AaBb Normal Heading 1 Heading 2 Heading Paragraph Styles 39) stored energy. is (are) the most abundant form of fats in our body and is (are) a good source of 40) T/F Glycogen, the storage form of glucose, is primarily stored in skeletal muscle and liver cells. Predictions: On You HeySEE MORE QUESTIONS
