Instr KXN302 Result 11.96 2.94 8.0 26.0 88.4 27.2 30.8 257 14.1 9.7 Test Code WBC RBC HGB HCT MCV MCH MCHC PLT RDWCV MPV Instr Comment Run 1 Prev Date 10/ Prev Res 14.64 3.75 10.4 33.0 88.0 27.7 31.5 370 13.8 9.7
Q: Assume the allele P¹ has a population-wide frequency of 0.001. What are the chances that a person…
A: The random mating is present in the population. This suggests that population is in Hardy Weinberg…
Q: Explain the Mechanisms and pathways of CCL22, SERPINE1, TIMP1, CX3CL1 genes to adenocarcinoma…
A: The inflammatory response can promote carcinogenesis by causing gene alterations, increasing…
Q: Examine the illustration below and answer the following questions: a. Compare fore-limb (arm) length…
A: Please follow step 2 for detailed explanation.
Q: Ⓒ→ [ooo 2 A UGG 3 сл G 1
A: Introduction :- The illustration is denoting the process of translation. After DNA is converted to…
Q: Image A Image B Image C A : Investigate I B C
A: Differential staining techniques are used to gather information about bacteria. These methods…
Q: analysis on the morality of abortion.
A: Various nations have labeled the right to abortion as a fundamental right. Internation Women's…
Q: List the types of adult tissues that are derived From each these > OF germ layers!
A: INTRODUCTION Three layers of germ cells Outer Ectoderm, middle mesoderm and inner endoderm.
Q: 24. In Drosophila melanogaster, ebony body (e) and rough eyes (ro) are encoded by autosomal…
A: Introduction :- A given gene is said to be autosomal if it is located on a numbered chromosome…
Q: Glucose molecules are linked together through dehydration synthesis to form starch. Based on this…
A: Gpucose is an example of simple carbohydrate molecule that is composed of carbon, hydrogen and…
Q: What are the Importance of the origins of amniotes?
A: All fully terrestrial vertebrates are classified as amniotes, which also includes all living reptile…
Q: Monotremata Metatheria Rodential Mammalia Theria Eutheria Primates Artiodactyla Carnivora Canidae O…
A: A clade is a group of organisms with common ancestor. Clade is derived from greek word "klados" that…
Q: 9) The accompanying pedigree is for a rare, but relatively mild, hereditary disorder of the skin. 1…
A: Inheritance patterns describes about the distribution of genetic variants in families. The disease…
Q: Boundary Condition (2) For each scenario, choose which boundary condition would be appropriate.…
A: Introduction:- The idealized laboratory setup was the is used to examine the influence of the…
Q: The major phenotype of deficiency of protolithic enzyme alpha-antitrypsin is the destruction of…
A:
Q: I. In the fruit fly Drosophila melanogaster, tan body color (B) is dominant to black (b), and dark…
A: The fundamentals of heredity were initially established by Gregor Johann Mendel in the middle of the…
Q: Pls help ASAP.
A: Introduction Aerobic respiration : Respiration is the metabolic process of most living things in…
Q: What type of study or design would help determine the association between being obese and developing…
A: A research design is a methodology or an approach that is implemented before conducting research, it…
Q: Consider a solute having a permeability coefficient of 10-6 m s-1 for the plasma membrane of a…
A: Diffusion is the process of movement of solutes from an area of high concentration to a low…
Q: We want to test different concentrations of an antibiotic to see how well it can kill bacteria on a…
A: Introduction:- The Agar dilution of the method is the currently the reference that standard the…
Q: Which RE’s from table below have a 5’ overhang? Which ones have a 3’ Overhang? AccI GT^CGAC…
A: Restriction enzymes are the specific enzymes that recognize and cut at specific sites on nucleotide…
Q: Provide and detail explanaton Adenocarcinoma tumours. how they impact the human body, how the…
A: Answer Adenocarcinoma is a form of cancer that develops in glandular (mucus-producing) cells. These…
Q: explain reciprocal inhibition, using the patellar tendon stetch relfex as an example
A: Reciprocal inhibition describes the relaxation of muscles on one side of a joint to accommodate…
Q: What is the importance of using freshly prepared KOH in testing the bacteria? Explain this…
A: During the twentieth century, most microorganisms were found and researched in labs. However,…
Q: Define and describe mechanisms of habituation, sensitization and memory as seen in Aplysia
A: It is essential to understand animal behavior under the influence of external stimuli. The response…
Q: Identify the two categories of lymphoid organs and their roles in the body's immune response.…
A: The maturation and multiplication of lymphocytes occur in lymphoid organs, which support the…
Q: Match the disease with the pattern of inheritance Phenylketonuria Achondroplasia Red-green…
A: The specific sequence of nucleotides is known as gene. It is present in DNA. It encodes protein.
Q: Most cells cannot harness heat to perform work because temperature is usually uniform throughout a…
A: Heat energy is a kind of kinetic energy which occur due to the movement of particles inside any…
Q: Provide evidence on the sequelae on how adenocarcinoma tumours
A: Adenocarcinoma tumors ( bowel cancer /colorectal cancer )develps in colon.this is the most common…
Q: A 7 year old female patient is admitted to a local hospital for a greenstick radius break. The…
A: Introduction A greenstick fracture happens when a bone fractures and bends rather than totally…
Q: Coenzymes function to: change the shape of enzymes, allowing different additional substrates to…
A: Introduction :- Many enzymes need coenzymes, which are organic substances, for catalytic activity.…
Q: When you measure blood pressure, the Korotkoff sounds (i.e. the sounds heard through a stethoscope)…
A: Introduction: Korotkoff sounds:- Korotkoff sounds are the sounds that medical personnel listen for…
Q: Identify two types of cells. Describe the identification of cells and the cell's other qualitative…
A: Eukaryotic cells with large central vacuoles, cellulose-containing cell walls, and plastids such as…
Q: If you had to sustain some kind of brain injury, which area of the brain would you be most…
A: Human brain is one of the most important parts of human body since, it controls nearly every aspect…
Q: What are genome?
A: The self-replicating bio-molecules that are present in chromosomes and carry genetic information are…
Q: 23. In tomatoes, dwarf (d) is recessive to tall (D), and opaque (light-green) leaves (op) are…
A: distance between the genes(m.u) = recombination frequency (%)
Q: The making of a covalent bond between two nucleotides requires the O dehydration synthesis the…
A: The bond is a kind of attraction which is present between two atoms. This is responsible for…
Q: Glycolipids and glycoproteins on membranes are most directly involved in _____________. Select one:…
A: Glycoproteins are chemical molecules made of a protein and a carbohydrate bound together, whereas…
Q: Where does the following reaction take place: isomerization of the 6-carbon molecule citrate Select…
A: The production of intermediate cis-aconitase converts citrate to isocitrate.This is a reversible…
Q: Chlorophyll is the dominant pigment in photosynthetic cells, and degrades earlier than carotenoids…
A: Chlorophyll is the dominant pigment in photosynthetic cells. and degrades earlier than carotenoids…
Q: In citrus fruits such as oranges and lemons, what composes the fleshy portion of the fruit? Explain…
A: Answer The orange's fleshy, sweet pulp is made up of juice sacs, which also provide the fruit with…
Q: Which protein organizes the cytoskeletons of cells along the medial-lateral axis during convergent…
A: Convergent extension is a mechanism for elongating tissues of an embryo. It consists of 2 steps-…
Q: When you measure blood pressure, the Korotkoff sounds (i.e. the sounds heard through a stethoscope)…
A: We know that In the human body, blood pressure is considered as the pressure exerted by the blood on…
Q: 12) Discuss Mendel's Laws of Dominance and Segregation and give two examples of exceptions to these…
A: Mendelian inheritance is the term used to describe certain patterns of how features are passed down…
Q: How does temperature affect how lactase drops work to break down lactose into glucose and galactose?
A: Disclaimer: - Out of the numerous questions present, the highlighted one will be answered. Please…
Q: Pls help ASAP.
A: Which of the following reaction is exergonic? The reactions can be classified based on the overall…
Q: give the types of gamets produced by a plant with round seeds and yellow cotyledons and gentype RrYy
A: Introduction The type of variant present at a specific locus (i.e., region) in the genome is…
Q: 2. Why in the lower extremities of a person the tone of the extensor muscles is greater than the…
A: Flexion and Extension are movements that take place within the saggital plane and that involve…
Q: Which of these statements are true about predictions and hypotheses? (4 are true) □ If the results…
A: The statements which are true about hypothesis and prediction are : A) if the result of the…
Q: Superoxide is produced in the _____________ and can destroy ______________. Select one: a. Citric…
A: Introduction :- Superoxide dismutases (SODs) are an essential antioxidant defence mechanism in the…
Q: During a PCR reaction, all the following events occur except: A. Hybridization B. Binding of a 3’OH…
A: PCR : it is polymerase chain reaction, it is a technique of molecular biology which is used to…
Based on these results, what is the most likely cause for the delta checks highlighted in green?
Step by step
Solved in 2 steps
- What is the apc payment for cpt code 78740?Based on the image below, select the correct statement. Complex II QH₂ Q- 10 2 HO 2 HO Fe-S (2.8 FADH₂ FAD- Succinate Fumarate https://canvas.uts.edu.au/assessment questions/356986/files/1562694/download? 2e verifier-eUTT3hYal2YYTWlywV8TIFA3USmzCsM52jECmvTo O Succinate is reduced to fumarate O Succinate is oxidised to FAD O The Fe-S center shuffles electrons from FAD to ubiquinone (Q) O The Fe-S center shuffles electrons from FADH2 to ubiquinone (Q) The Fe-S center shuffles electrons from FADH2 to ubiquinonol (QH2) W 88 16°C-t=449595&cmid=1668389 textb... My ATI NOLOGY SUPPORT ✓ MTH 208-01 (MW... K Kaplan Login WP WileyPLUS VitalSource Books... Zika virus is chiefly spread using an insect vector, more specifically, mosquitoes. Given this, which of the following helps account for why all blood donations in J.S. are screened for Zika? O a. Zika can be easily transmitted from person to person even through incidental contact O b. Zika infections are now common and regularly reported in every U.S. State (except Alaska) O c. Screening of blood donations is the main way in which Zika infections are diagnosed in the U.S. O d. Climate change extends the habitat of mosquitoes that can carry the virus Next page
- Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below. wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 ****** ***************************************************** wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 ************************************************************ wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147 sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147 Answers: A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold B) The observed mutation is a negatively charged to a polar amino acid. Such a change…Sequence A: TCT/ TCC/ CTC/ CTA/ AAC/ GTT/ CAA/ CCG/ GTT/ CTT/ AAT/ CCG/ CCG/ CCA/ GGG/ CCC/ CGC/ CCC/ TCA/ GAA/ GTT/ GGT AGA Sequence B: TCA/ GAC/ GTT/ TTT/ GCC/ CCG/ TAA/ CAA/ CTT/ GTT/ ACA/ ACA/ TGG/ TCA/ TAA/ ACG/ TCA/ GAG/ ATG/ GTC/ AAT/ CTC/ TTA/ ATG/ ACT Sequence C: TAT/ ATA/ CAT/ GTA/ AAC/ ACA/ TAC / TCA/ GTG/ GAC/ CAA/ CTC/ AAC/ ATA/ AAC/ CAA/ ACA/ CCG/ CTC/GCG/ CCG/ AAA/ AAG/ ATA/ TGG STEP 1: Transcribe each of the 3 DNA sections into nRNA. Write out the complementary CODONS directly below the DNA strands. STEP 2: Clearly identify the three fragments as the FIRST, SECOND and THIRD fragments by clearly labeling any obvious PROMOTERS, START and STOP codons. STEP 3: Number the the START codon #1 and number the codons in the correct order until the STOP codon is reached. STEP 4: Codons 14- 64 (including 14 & 64) represent an intron. Draw a single red line through these codons to indicate that they will NOT be translated. STEP 4: In the space provided, write out the…EcoRI 4359 Aatll - Zral 4284 Bei 4209 BsrBl 4205 Clal - BspDI 23 Hindill 29 EcoRV 185 Bmtl - Nhel 229 Sspl 4168 Earl 4155 Acul 4048 Xmnl 3961 Hincll 3905 Scal 3844 BamH 375 Sgrl 409 Banll 471 Banll 485 Вы 3787 Bsl 3759 Bgl 528 Sphl 562 EcoNI 622 Sal - Acct - Hincll 651 Pvul 3733 Pstl 3607 Bartl 3602 Pshl 712 Asel 3537 Eagl 909 Bell 949 Bsal 3433 BarDI 3420 Nrul 972 PBR322 4,361 bp BstAPI 1045 Ahdi 3361 BspMI - Bfual 1063 PAMI 1315 Bsml 1353 PAMI 1364 Acul 3000 Ori Styl 1369 Aval - BsoBl 1425 PpuMI 1438 Msel 1444 Bigl 1447 Ppu 1480 AlwNI 2884 Bell 2777 kI 2682 rop Drdi 2575 Bsgl 1650 BspEI 1664 Pcil - Afl 2473 rBl 2404 Earl 2351 Bspol - Sapl 2350 Ndel 2295 BstAPI 2291 Bsaß 1668 Xmat 2029 Pvull 2064 BsmBI 2122 Dndl 2162 BstZ171 - Acct 2244 Bsal 2225 TthI- PI 2217 Figure 1 If your gene of interest was inserted at the Sphl restriction site of the plasmid illustrated in Figure 1, describe the screening process to select the positive recombinants.
- Please read these results and explain them briefly in a way that is understood https://mdpi-res.com/d_attachment/ijms/ijms-21-05129/article_deploy/ijms-21-05129.pdf?version=1595262192S Savwas Rea lize NGSS ommunity/classes/da298ebd9 c514500827f97e044ab6ee8/assignments/2c3a 98df8d654edaab97cc6399 5c23fd/content/1ccf1054-b803-361d-b16a-8b4 G saint mother teresa. A Sa int Report K Maddox Bry ant - gr. Vs-nhm Growth lan's father keeps bees, and lan spends time observing their behavior. He is especially interested in bee communication and has even seen the waggle dance. The waggle dance communicates the location of food to other bees in the hive. All honeybees know the waggle dance from birth. Choose the correct words to complete the sentences. The waggle dance is an example of a(n) Choose... behavior, because bees can perform it correctly the first time. Bees exhibit Choose... Choose... ovide food and protection for the hive's young. learned predatory courtship instinctive1 10 20 30 40 50 60 70 -I---- 5' АTCGGTCТCGGCTACTACАТАAАСGCGCGCATATATCGAТАТСТАGСТАGСТАТCGGTCTAGGCTACTАC 3' TAGCCAGAGCCGATGATGTATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGATCCGATGATG I--------I--- --I--- --I------ --I--- -I---------I Promoter 80 90 100 110 120 130 140 -I---- 5' CAGGTATсGGTCTGATCTAССТAGCTTCTтсттстстстстсссссGCGGGGGCTGTACTATСATGCGTCG 3' GTCCATAGCCAGACTAGATCGATCGAAGAGAAGAGAGAGAGGGGGCGCCCCCGACATGATAGTACGCAGC -I- -I------- -I--- -I---------I RBS 150 160 170 180 190 200 210 -----I--- ---I-- ------I- ---I---------I---- -I---------I 5' тстCGGCTАСТАCGTAAACGCGCGCATATAтCGATATCTAGCТAGСТАТСGGTстCGGCTACTAсGTAAA 3' AGAGCCGATGATGCATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGAGCCGATGATGCATTT 220 230 240 250 --I----- ---I-- ------I--- -I 5' CCCTATTAGCATGGGTCATATTTGTGTCTGCTTGTTGGGT 3' GGGATAATCGTACCCAGTAGAAACACAGACGAAGAACCCA a. What are the nucleotides of the MRNA from gene Z? b. What are the amino acids encoded by gene Z? ( Vate V
- explain this result in a brief and clear way, Here is the link where the image came from: https://mdpi-res.com/d_attachment/ijms/ijms-21-05129/article_deploy/ijms-21-05129.pdf?version=159526219222:23 1O 000 · 11:24 A9 OB1 r ll l 52% . +964 782 734 3923 2m541139927815107... Patient Encounter Part 3 The pretreatment workup is summarized below. Pathology: 47-year-old female with new diagnosis of infiltrating intraductal adenocarcinoma involving the left breast and regional node. Further tests on tumor samples indicated ER (8%), PR (negative), HER2 (negative), Ki-67 (72%), and grade (poorly differentiated). Intrinsic subtype (luminal B, HER2-negative). Radiology: FDG-PET/CT indicated a 5.3 x 2.5 cm mass in the left breast which appeared to extend to the epidermis of the skin; one node in the left axilla was also involved with tumor. No other evidence of distant disease was visualized. Laboratory: CBC, liver, and kidney function tests WNL, alkaline phosphatase and calcium are normal also. Stage: IB (T, N, M,) List the most important prognostic factors in this patient with newly diagnosed breast cancer. Assess the patient's level of risk for relapse. 50 SECTION 16 | ONCOLOGIC…https://youtu.be/w7aIxiZQ60g Multiplexing agglutination https://youtu.be/uWStmyJ5Qc0 This is the multiplexing agglutination. Lab report I don’t really know what to talk about, the data, conclusions and the purpose of this. Need help please