Genetics Lab Report 2

Topic: Recombinant pharmaceuticals (for the production of insulin, human growth hormone or blood clotting factors) Question What are the drawbacks/disadvantages/unknowns associated with this genetic process?

fueled.brightspace.com/d2l/le/enhancedSequenceViewer/3300467?url=https%3A%2F%2Ff59af8a9-95f5-419c-a486-a A rdschools.com bookmarks Drive Classes B Login Page Sign In Education and Lear... Content = 1.08 Unit Test: Gene Expression - Part 1 Which statement is most accurate? Hair is different from kidneys because the cells that make up hair and kidneys have different genes All cells have the same genes, but different genes are active in different cells. As cells and tissues differentiate, they produce new genes. All cells have the same genes, and all of a cell's genes are active at the same time. #m C $ J лае 1 2 3 4 5 & 7 8

The genome of Daphnia pulex, a small freshwater crustacean, includesapproximately 30,000 genes in ∼200,000 kb of DNA. How does the genome compare to that of Drosophila melanogaster, another arthropod, and to that of humans?

Preimplantation genetic testing for aneuploidy (PGT-A) is meant to identify and discard embryos with chromosome number abnormalities.  However, it has not been proven to be valuable in human IVF.  What do you think PGT-A is not working as expected

Evidence [see P. G. Shiels, A. J. Kind, K. H. Campbell, et al. (1999),“Analysis of telomere lengths in cloned sheep,” Nature 399, 316–317] suggests that Dolly may have been genetically older than heractual age. As mammals age, the chromosomes in somatic cells tendto shorten from the telomeres. Therefore, older individuals haveshorter chromosomes in their somatic cells than do younger ones.When researchers analyzed the chromosomes in the somatic cells of Dolly when she was about 3 years old, the lengths of her chromosomeswere consistent with those of a sheep that was significantlyolder, say, 9–10 years old. (Note: As described in the chapter, thesheep that donated the somatic cell that produced Dolly was 6 yearsold, and her mammary cells had been grown in culture for severalcell doublings before one of the cells was fused with an oocyte.)A. Suggest an explanation why Dolly’s chromosomes seemedolder than they should have been.B. Let’s suppose that a female sheep (like Dolly), which…

a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSP

| Choose ) [ Choose] metagenomics whole-genome shotgun approach bioinformatics ed GenBank genomics

ME History Bookmarks Profiles Tab Window Help ucture.com/courses/47420/quizzes/225324/take Question 3. Choose the best method (from lectures 19-21) for each of the following experiments. You want to determine the transcriptomic response to heat shock in [ Choose ] a normal cell line. You'want to measure the quantity of mRNA of your gene of interest in sepal vs petal cells. [ Choose ] You want to identify the mutation that has occurred in your gene o V [ Choose ] interest after EMS mutagenesis. CRISPR Map based sequencing or whole genome shotgun sequencing You want to know the DNA sequence of all of the genes in a Recombinant DNA genome. Restriction enzyme digest RT-PCR or qPCR You want to make large quantities of DNA of your gene of interest from a tiny amount of DNA. Sanger sequencing PCR You want to determine the differences between the proteins made Cloning in the sepal vs petal cells. Microarray or RNA-seq Proteomics Question 12

Bioinformatics is an interdisciplinary field that integrates knowledge of computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (1) What does BLAST stand for? (ii) Explain the function of BLAST.

of [ Choose J | Choose ) [Choose ) ent] in situ hybridization nucleic acid probe cing reverse transcriptase-polymerase chain reaction (RT-PCR) RNA sequencing or RNA-seq DNA microarray assay

Discuss how the genetic basis of life plays a central role in biotechnology.  Further, ethical considerations aside, if DNA-based technologies became widely used, discuss how they might change the way evolution proceeds, as compared with the natural evolutionary mechanisms that have operated for the past 4 billion years.

Cap, EA1, and Sap are all genes/proteins of interest in this study. For each gene, what gene product is encoded and where is the gene (the literal DNA sequence) located physically in the cell?    I need help fimiding this in the artticle and answer as short as possible  https://www.ncbi.nlm.nih.gov/pmc/articles/PMC106848/

Give (3) three applications or uses of Human Genome Project and briefly explain each..

(E) identify the source of DNA material Questions 21-23 A culture of white-eyed fruit flies (Drosophila melanogaster) was maintained for many generations. Females from the stock white-eyed culture were crossed with red-eyed (wild-type) males. The F1 females were crossed with the white-eyed males from the original culture. The resulting phenotypes of the progeny are summarized below. Parental Generation Cross F1 Generation (at least 500 flies) 100% of females are red-eyed 100% of males are white-eyed White-eyed females x red-eyed males F1 Generation Cross F2 Generation (at least 500 flies) Fl red-eyed females x white-eyed males 50% of females are red-eyed and 50% are white- eyed 50% of males are red-eyed and 50% are white-eyed 21. The best explanation for the red-eyed F1 females is (A) mutation (B) culture contamination (C) dominance (D) multiple loci (E) sex-influenced traits 22. There are white-eyed females in the F2 generation because (A) white is a dominant allele (B) the white…

ugence gence.com/student/studentformative/ Juan Bonilla Velasquez > Nimitz 20-21: CA Biology ProSyn & Mu Online Tools A Question 8 Next + Previous Question 8 (2016 6D) Human bone, muscle, and nerve cells all contain the same number of chromosomes with the same complement of genes. What enables these cells to perform specialized activities? Answer F The ability of some cells to remove unnecessary DNA sequences The regulation of gene expression within each cell type The mutation of genes within each cell type The use of different methods of cell division Question 8 Next + Previous Technologies Inc2021 Edugence Sign out

Hello! I have a topic to discuss for tommorow! The question goes like this: Discuss how the genetic basis of life plays a central role in biotechnology. Further, ethical considerations aside, if DNA-based technologies became widely used, discuss how they might change the way evolution proceeds, as compared with the natural evolutionary mechanisms that have operated for the past 4 billion years.

Preview File Edit View Go Tools Window Help )) 100% Thu Apr 29 10:44 PM A BI-201 Syllabus Virtual Spring 2021.pdf (page 1 of 19) A BioLab Fly_Group_F.pdf (page 1 of 4) Q Search DOCX v BioLab Fly Group_F.pdf HIST111 signment1 Mutation: Lobe eye shape P generation Phenotypes: Normal Lobe DOCX _female X male W1 - Puffins F. generation Phenotype Females Males Total Ratio Normal 8. 8. Lobe Screen Shot 021-04..3.03 AM F, XF, Phenotypes: Normal Normal female X male DOCX F2 generation HIST111 Phenotvoe Females Males Total Ratio Normal 6 6 Lobe 2 2 F. Punnett square F2 Punnett square DOCX HIST111 2 2 Atomic This mutation is inherited as: uctur...pdf .pdf dominant autosomal (da) recessive autosomal (ra) DOCX recessive sex-linked (rs) History homework4 APR 29 X FENE

If you wanted to make a mouse model for any of the following human genetic conditions (a–d), indicate which of thefollowing types of mice (i–vi) would be useful to your studies. If more than one answer applies, state which type ofmouse would most successfully mimic the human disease:(i) transgenic mouse overexpressing a normal mouse protein; (ii) transgenic mouse expressing normal amounts of amutant human protein; (iii) transgenic mouse expressing adominant negative form of a protein; (iv) a knockout mouse;(v) a conditional knockout mouse; and (vi) a knockin mousein which the normal allele is replaced with a mutant allelethat is at least partially functional. In all cases, the transgeneor the gene that is knocked out or knocked in is a form of thegene responsible for the disease in question.a. Marfan syndrome (a dominant disease caused byhaploinsufficiency for the FBN1 gene);b. A dominantly inherited autoinflammatory diseasecaused by a hypermorphic missense mutation in thegene PLCG2;c.…

Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatic tools for gene prediction, homology modelling and such are available free online. State the functions of CLUSTAL W, BLAST and GLIDE (Schrödinger).

Which of the following mutational changes wouldyou predict to be the most deleterious to gene function?Explain your answers. 1. Insertion of a single nucleotide near the end of thecoding sequence.2. Removal of a single nucleotide near the beginningof the coding sequence.3. Deletion of three consecutive nucleotides in themiddle of the coding sequence.4. Substitution of one nucleotide for another in themiddle of the coding sequence.

Question 17 How do we go from a genetic association to a causal relation between a gene and a phenotype? ◇ We can use a GWAS with many different samples to identify causal alleles. O We can quantify gene expression of a gene of interest and determine the relationship with a phenotype. O We can determine how often an associated allele occurs in cases that have a disease, which will allow us to determine a causal relationship. By silencing a gene, we can study the effect of that gene on the phenotype. Question 18 What is the function of the CRISPR-Cas system in nature? O part of the bacterial immune response against viral infection a molecule involved in regulation of expression

True or False: Write Tif the statement is true and F if it is false. 1. Mutagens are commonly in the form of toxic chemicals, and harmful radiation. _2. A mutation is a change in the base sequence of RNA 3. Mutations can occur in two different types, the body and the reproductive cells. _4. Mutations affect the reproductive cells of an organism by changing the sequence of nucleotides within a gene in a sperm or an egg cell. 5. Mutations may affect only one gene, or they may affect whole chromosomes.

6 1117121 There are several main model systems through which the first set of major breakthroughs in the understanding of cell cycle control was made. Indicate whether each of the following statements is likely to be true or false for this initial phase of discovery. [ Select] identifying genes important for cell cycle regulation. [Select] The frog egg system was critical for developing genetic screens for M Cytoplasm extract from plant cells was used to identify factors important for cell cycle progression. Q Search 15 do $***** ***** 1991 99+ ◄- app.honorlock.com is sharing your sc ** 4+ a hp

Illustrate about the Map and sequence the genomes of several model organisms used in experimental genetics, including Escherichia coli, Saccharomyces cerevisiae, Caenorhabditis elegans, Drosophila melanogaster, and Mus musculus (mouse).

1) Do you agree or disagree with this statement? Transposons can cause genomic rearrangements or genomic expansion compared to microsats, which are only associated with genomic expansion. Explain your response.   2)   Do you agree or disagree with this statement? Since bone is a non-living structure, it would not be useful for genomic profiling. Explain.

Question:- 1. A brand-new deleterious allele has just entered a population via mutation; this allele had not existed before in the population. If its allele frequency in the next generation is 0.00000021, what must have the mutation rate have been of these gene? 2. Use #1 to answer. Using standard scientific notation format, enter the exponent (including the negative sign).

Hi, I would like to know which program is used for the graphical presentation of the results of a meta-analysis of genome-wide linkage scans?

Question:- 2. How could multi-genes families complicate things in terms of using CRISPR to knock out a target gene and achieve a target phenotype?