What secondary structural elements are most likely present in this sequence? Please annotate the sequence to show where these structures begin and end.
Q: Palmitic acid is synthesized from the excess citrate from increased catabolism of glucose that…
A: The process of glycolysis occurs in the cytoplasm of the cell irrespective of the presence or…
Q: Intermolecular forces of attraction, such as hydrogen bonding and van der Waals forces, are…
A: Non-covalent interactions play a major role in the assembly and function of biological…
Q: At which pH would the structure shown be predominate? H₂N-CH- - H OpH 1 pH 3 pH 8 pH 11 0 0
A: Glycine has the simplest structure among all the amino acids. This side chain of amino acid has most…
Q: Which of the following mutagens results in the deamination of nitrogenous bases? O nitrous acid base…
A: The amino bases adenine and cytosine lose one amino group when they are oxidised. As a result, in…
Q: A student Hussein woke up early and then went quickly - without having breakfast - to Al-Maaqal…
A: Glucose is a very important source of energy & it is required by our body to carry out normal…
Q: Vitamin A's two best studied forms and functions are both rhodopsin action and gene expression…
A: Vitamin A is a fat soluble vitamin. This vitamin can be reversibly converted to the aldehyde…
Q: A patient of 28 years old complains of pains in the spine, persistent arterial hypertension. On…
A: Hi! Since you have posted a multiple subparts questions and haven't mentioned which subparts to be…
Q: I' H I "H HO Choose all of the following are true of the given structure? (Choose all of the correct…
A: The major biological macromolecules are nucleic acid, proteins, lipids and carbohydrate. The four…
Q: 10. In a protein, the amino acid pairs below are near each other in the tertiary structure. For each…
A: Proteins are polymers of amino acids linked by peptide/amide bond (Covalent). Primary Structure of…
Q: 1A. The pyruvate dehydrogenase complex is heavily regulated as the nexus between glycolysis and the…
A: "Since you have asked multiple subparts of a questions, we will solve the first two subparts of the…
Q: 6. Succinate dehydrogenase couples the activity of the citric acid cycle with that of the electron…
A: Succinate dehydrogenase is an enzyme located in the inner mitochondrial membrane. It has FAD as its…
Q: Where in cells does the TCA cycle occur? a. Mitochondrion matrix b. Mitochondrion intermembrane…
A: Introduction: TCA (tricarboylic acid cycle) is a cycle which takes place in eukaryotes. In this…
Q: Question:- What is an example of a heterotrimeric G protein and what role does it play?
A: G proteins are guanosine binding proteins. That is, they can bind to GTP and GDP. Monomeric G…
Q: Which one of the following statements comparing alpha keratin and silk fibroin is a true statement?…
A: Introduction: Alpha-keratins are proteins that form tough fibers and are found in hair, nails, and…
Q: Name the given substance. What pharmacological group does it belong to? CI -OH
A: The answer to the above question is provided below.
Q: You apply a new drug to a different batch of neurons and record membrane potential changes in the…
A: Permeability barrier and semi permeability of cell membrane are both maintained by lipids. only…
Q: Bile acids are detergents made by the liver O True O False
A: Bile acids is the product secreted by liver by found in bile juice. Bile juice is stored in gall…
Q: 1) under intracellular conditions, answer : If G3P-DH is inhibited by Iodoacetic acid, which…
A: Note : Hi ! Thank you for the question. We are authorized to answer one question at a time. Since…
Q: If your body does not take in protein, but only carbohydrates and lipids, what atoms will it be…
A: Introduction: Macromolecules are large molecules that perform many biological functions in our…
Q: Calculate the ATP yield from full oxidation of the fatty acids from a triglyceride with 3, 22 carbon…
A: Fatty acids are released in the digestion of triglycerides. These fatty acids undergo beta oxidation…
Q: Question #3 Complex III (cytochrome bc₁ complex) in the electron transport chain transfers electrons…
A: Hi! Thank you for the question. We are authorized to answer one question at a time, since you have…
Q: Elevated Na in the diet is thought to cause pathologies due Direct organ stress and elevated blood…
A: Sodium level in the body of humans should be between 135 as well as 145 milliequivalents per litre.…
Q: The reaction of glutamate and NH4* to yield glutamine is catalyzed by a) Uridylyltransferase b)…
A: Glutamine and glutamate are important amino acids for the metabolism of body. Though they are not…
Q: When activated extracellularly, G protein-coupled receptors (GPCRs) initiate which of the following?…
A: Introduction: G-proteins referred to as guanine nucleotide-binding proteins, that are required for…
Q: 1.Hexokinase binds D-glucose but not L-glucose. This is an example of? Chirality sustrate…
A: The active site of an enzyme is unique to itself and Enzymes are fomr of L- amino acids fold in…
Q: Your friend Jamie has been smoking something in order to lose weight. Jamie tells you that smoking…
A: Note: Since you have posted a question with multiple subparts, we will solve first three sub parts…
Q: What constitutes the backbone of a nucleic acid?
A: Introduction: A nucleic acid is a biological large molecule composed of nucleotide chains. These…
Q: UV light causes the conversion of a dietary form of vitamin D into vitamin D3 True O False
A: Vitamin D is the sunshine vitamin. Sun induced vitamin D synthesis is greatly influenced by season,…
Q: Cholesterol is An essential lipid molecule we can only obtain by ingestion O An essential lipid…
A: Cholesterol is a neutral lipid. It is a type of sterol. It is plays very important in the body by…
Q: Draw the peptide PVLED and determine the following: Isoelectric point, pI The net charge at pH =…
A: The given peptide is composed of proline, valine, leucine, glutamic acid, and aspartic acid. The…
Q: Consider the mRNA sequence below. Assume that the following mRNA segment has been translated.…
A: Translation is the process of synthesis of proteins from mRNA. During the process of translation,…
Q: What is biochemistry
A: Biochemistry is the branch of science that investigates the chemical processes that take place…
Q: Write a paragraph or more to introduce the enzyme catalase. Include the following details in your…
A: The enzyme catalase is found in nearly all living organisms that are exposed to oxygen. This enzyme…
Q: Reducing power for the synthesis of fatty acids is produced in which reactions? conversion of…
A: The fatty acid synthesis starts from acetyl Co-A which is an intermediate of the TCA cycle. The…
Q: For i) fresh milk casein, ii) raw egg protein, explain from the protein structure why it can…
A: Proteins are classified as a very large types of biomolecules. These are the ones that are made up…
Q: What is the actual meaning of Biocompatible and biodegrable for the scaffolds for biomedical…
A: The property of material compatible with living tissue is called biocompatibility. Biocompatible…
Q: H₂C0- HC- -0- H₂C- O 110 0=U O=U 0 www M_ MAAA wwwww
A: Triglyceride is a molecule that is composed of glycerol attached to three fatty acyl chains.…
Q: Explain what you understand by the term 'selectivity' with the respect to molecules binding to the…
A: A receptor is a protein molecule that binds to its specific ligand. The receptor molecules generally…
Q: Use the table below to identify the oil sample being described/ asked. Oil sample % Fatty acid by…
A: Unsaturated fatty acids are the fatty acids with one or more double bonds. Iodine is a halogen that…
Q: student performs a separation by TLC on a silica get plate that results in three spots. A red spot…
A: Introduction: Thin-layer chromatography (TLC) is an important technique for the identification and…
Q: What is the role of the heme prosthetic group in hemoglobin? A. The heme group coordinates the…
A: Heme : It is iron containing molecule being important for the biological processes. 1 hemoglobin…
Q: The "energy balance model" of body mass is based on the idea that biological systems neither create…
A: Energy intake, energy expenditure, and energy storage are the three basic components of energy…
Q: How the different types of fats in one’s diet can help correct or prevent heart disease
A: Fat is an essential part of diet that have different important role in the body. Mainly these are of…
Q: Which of the following statements is true? a) High insulin/glucagon ratio activates lipolysis in…
A: Lipolysis is the process in which the lipid, triacylglycerol is broken down into its components…
Q: Please answer fast In an enzyme-catalyzed reaction, the rate of the reaction depends on which of…
A: Enzymes are biocatalysts which increase the rate of biochemical reactions. The rate of an enzyme…
Q: Which one is most likely the father? Mother Child Dad 1 'Dad 2 Dad 3
A: DNA finger printing is a technique used in forensic medicine. This technique helps to identify the…
Q: f the following statements is/are FALSE? aramagnetic metal ions can have an odd number of electrons.…
A: The crystal field theory is used for giving the description of the metal-ligand bond. The…
Q: From the Lineweaver-Burke plot of an enzyme-catalyzed reaction containing 4 μM total enzyme, you…
A: Hi. Thank you for the question. As per the honor code, We'll answer the first question since the…
Q: Define what a hydrogen bond is and illustrate how two peptide bonds can be hydrogen-bonded to each…
A: Water molecules, DNA double-strand bindings, proteins, and other molecules all contain hydrogen…
Q: Liver metabolism of fructose uses the same glycolytic enzymes to generate distinct products O…
A: chemical reactions that follow various steps are called metabolic pathways which are often linked by…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Ile-Ala-His-Thr-Tyr-Gly-Pro-Phe-Glu-Ala-Ala-Met-Cys-Lys-Trp-Glu-Ala-Gln-Pro-Asp-Gly-Met-Glu-Cys-Ala-Phe-His-Arg What will be the secondary structure formed from this sequence?Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSAAmino acids project from each polypeptide backbone in a β-sheet in an alternating fashion (oneabove the plane and the next below the plane – see Fig 3.8B). Consider the following proteinsequence: Leu-Lys-Val-Asp-Ile-Ser-Leu-Arg-Leu-Lys-Ile-Arg-Phe-Glu.a. Is there a pattern to these amino acids? If so, what is it? b. What does this sequence of amino acids mean for the hydrophobicity/hydrophilicity of theresulting β-sheet? c. Can you make a prediction about how the β-sheet will be arranged in higher levels of protein structure? If so, what prediction would you make?
- Given below is a sequence of a polypeptide: AVLLRKIFWFDLAG The pKas of different groups/side chains are shown in the table below: Group/side chain pka C-terminus 3.5 Asp 3.9 Glu 4.1 His 6.0 Cys 8.4 Tyr 10.5 Lys 10.5 Arg 12.5 N-terminus 9.0 What is the total charge of this molecule at pH 11? [ Select ] What is the total charge of this molecule at pH 13? [ Select ] What is the isolectric point for this molecule? (Select]The bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.A protein has been sequenced after cleavage of disulfide bonds. The protein is known to contain 3 Cys residues, located as shown here. Only one of the Cys has a free —SH group, and the other two are involved in an —S—S— bond. The only methionine and the only aromatic amino acid (Phe) in this protein are in the positions indicated. Cleavage of the intact protein (i.e., withdisulfide bonds intact) by either cyanogen bromide or chymotrypsin does not break the protein into two peptides. Where is the —S—S— bond (i.e., AB, BC, or AC)?
- Remembering that the amino acid side chains projecting from each polypeptide backbone in a β sheet point alternately above and below the plane of the sheet, consider the following protein sequence: Leu-Lys-Val-Asp-Ile-Ser-Leu-Arg- Leu-Lys-Ile-Arg-Phe-Glu. Do you find anything remarkable about the arrangement of the amino acids in this sequence when incorporated into a β sheet? Can you make any predictions as to how the β sheet might be arranged in a protein?TERTIARY STRUCTURE (A) (B) (C) Fg Eet Galand Sen 20e Figure 6. Examples of the arrangement of a-helices and B-sheets in folded protein domains. Copyright 2013 from Essential Cell Biology, 4th Edition by Alberts et al. Reproduced by permission of Garland Science/ Taylor & Francis LLC. Figure 6 shows three examples of how secondary structure elements can be arranged in relation to one another in the functional, folded form of a complete protein or one compact portion of a protein. The overall three-dimensional shape (or conformation) of a protein is its tertiary structure. • What do you think holds together the various secondary structural elements in a particular three-dimensional pattern? (Hint: Look back at Figure 5 - what is sticking out from the sides of the a-helices and B-strands?)Treatment of a polypeptide by 2-mercaptoethanol yields two polypeptides that have the following amino acid sequences: Ala-Phe-Cys-Met-Tyr-Cys-Leu-Trp-Cys-Asn Val-Cys-Trp-Val-Ile-Phe-Gly-Cys-Lys Chymotrypsin-catalyzed hydrolysis of the intact polypeptide yields polypeptide fragments with the following amino acid compositions: (Ala, Phe) (Asn, Cys2, Met,Tyr) (Cys, Gly, Lys) (Cys2, Leu,Trp2,Val) (Ile, Phe,Val) Indicate the positions of the disulfide bonds in the original polypeptide. I don't understand how the order of amino acids in Step 2 was arranged. Please explain. Thank you.
- In the molecule of oligomeric protein there are 19 lysine residues. 12 of them may be easily acetylated with anhydrides of dicarbon acids (it react with NH2-groups). The acetylation of extra two residues of lysine will dissociate the protein to the subunits. The rest 5 lysine residues may be modified only after denaturation of the protein. Suggest, how many lysine residues are: a) on a surface of protein globule; b) inside globule: c) in a site which is responsible for the contact within subunitsTreatment of a polypeptide by 2-mercaptoethanol yields two polypeptides that have the following amino acid sequences: Ala-Phe-Cys-Met-Tyr-Cys-Leu-Trp-Cys-Asn Val-Cys-Trp-Val-Ile-Phe-Gly-Cys-Lys Chymotrypsin-catalyzed hydrolysis of the intact polypeptide yields polypeptide fragments with the following amino acid compositions: (Ala, Phe) (Asn, Cys2, Met,Tyr) (Cys, Gly, Lys) (Cys2, Leu,Trp2,Val) (Ile, Phe,Val) Indicate the positions of the disulfide bonds in the original polypeptide.0ミレーNレ NH geometry on both cand N. Torigonal plannes CH - C-N o=), HN CH2 CH-C-OH (a- carbon) CH2 HooC Aspaxagine - Toline - Valine - Arginine - phenylalcmine - Glutamic ocid. 1.Give the name and three letter code for each amino acid in the peptide. e 2. At pH 7, approximately what charge would be on your peptide? Explain your answer. 3. Can your peptide form intra/interchain disulfide bonds? Explain why/why not. e 4. Will your peptide absorb UV and is it fluorescent? Explain why/why not. e 5. What is the probability that your peptide contains a cis peptide bond? Explain your answer.