Q: For a hexaploid what is the value of x where x refers to the basic chromosomenumber that makes up a…
A: Ploidy refers to the number of chromosomes present in the nucleus of a cell. In normal somatic…
Q: Differentiate between D-value and z-value.
A: Introduction Sterilization is the process of completely eliminating or destroying all microbial…
Q: What does the expression linear octad analysis mean?
A: Fungi are eukaryotic heterotrops that grow and form thread like structures called hyphae to form a…
Q: What family gene means and How do you name a gene?
A: Mendel proposed that something was being passed down from the parents to offspring through the…
Q: What does the expression wild type mean?
A: Genetic traits are regulated by genes.
Q: Is a gene a triplet ofconsecutive DNA nucleotides?
A: DNA is the genetic material in most living organisms. It is the information hub of the cell that…
Q: To what do the four pairs of class sizes (very big, two intermediates, very small) correspond?
A: Class size is determined by the number of organisms belonging to that class. In genetics, a double…
Q: each member of the gene pair come from?
A: Diploid organisms have a pair of genes
Q: what is the phenotype of the attached images?
A: Genes are the functional unit of heredity. It carries information from one generation to another.…
Q: hair, underdeveloped nails, and abnormally shaped eyelids. In the following pedigree, which…
A:
Q: What is Tetrasomy 18p?
A: Chromosomes are thread-like structures located inside the nucleus of animal and plant cells. Each…
Q: which are the two genes are said to be syntenic?
A: Genes are the basic structural and functional units of heredity. They are composed of…
Q: What does the symbol arg-1 mean? How would you test for this genotype?
A: The names of the gene must be informative as well as concise. Every gene name should be exclusive…
Q: In general, why do changes in chromosome structure or numbertend to affect an individual’s…
A: Chromosome is a compact structure of a DNA molecule wrapped around some proteins. It is generally…
Q: Fill the punnet square for just cross 2 and then do the chi square by using the observed values of…
A: The Chi-square test helps to understand if the given cross fits within the Mendelian rations and…
Q: In a two factor cross, the longest possible map distance is 50 map units. Explain why this is…
A: By finding the recombination frequencies of many gene pairs, we can make genetic or linkage maps. By…
Q: If a Punnett square is used to visualize a three-factor cross (trihybrid cross, e.g. YyTtRr x…
A: Punnet square is a diagrammatic representation in form of a box in which parental genotype is…
Q: The following diagram represents two nonhomologous chromosomes: A B • C D E F G R S • T U V W X What…
A: There are four types of chromosomal mutations: deletion, duplication, inversion and translocation.…
Q: What the gene product
A: Gene regulation in bacteria Introduction We tend to think of bacteria as simple. But even the…
Q: Which one cannot be a reason for chromosome disjunction anomaly?
A: Disjunction anomaly When the chromosomes of a cell unable to separate and each daughter cells got…
Q: Define the class-aves and its structure?
A: Vertebrates are those organisms that have a spinal cord and it is surrounded by bone or cartilage.…
Q: The type of linkage labeled C below is:
A: nucleotides are formed by adding a base and phosphate group to the ribose or deoxyribose sugar…
Q: Who was Mitochondrial Eve?
A: According to Abrahamic religion we come across theory of The Adam & The Eve who are 1st man…
Q: a. Does the Punnett square represent a monohybrid cross or a dihybrid cross? How do you know?
A: Introduction :- A monohybrid cross is the hybrid of two individuals with homozygous genotypes which…
Q: Explain what the word nondisjunction means?
A: Cell biology is the field of biology that studies the cell’s function and structure.
Q: If d and f = 2%, what is the correct arrangement of the genes d,e,f?
A:
Q: In a tetraploid B /B /b /b, how many quadrivalent possiblepairings are there? Draw them (see Figure…
A: The number of sets of well define chromosome that is term as homologous chromosomes in a cell's or…
Q: Which are two important facts about the tetrads?
A: As we know all living organisms are made of basic unit of structure and function called as cell.…
Q: The pedigree below shows the recurrence of a rare neurological disease (large black symbols) and…
A: This information in the given pedigree can be solved by: There is a mutation in the progenitor cells…
Q: What is a Nucleoid and where is it found?
A: Prokaryotes are single-celled organisms and do not have a separate nucleus. These include archaea…
Q: A cross between two heterozygous individuals in one gene resulted in one phenotype, explain?
A: Sir Gregor Mendel was a priest and a teacher who did the famous hybridization experiment on garden…
Q: This pedigree shows the segregation of a rare disease in a family. What is the most likely mode of…
A: Answer: PEDIGREE CHART : It is the genetic chart of the generations which is used to study the…
Q: Why is chromosome 21 the smallest and not chromosome 22? considering that a karyogram is arranged…
A: Introduction: In the nucleus of each cell, the DNA molecule is bundled into thread-like structures…
Q: Using the letter T to represent the trait, what is the genotype for individual 7?
A: The correct answer to this question is: D. It is impossible determine from this picture.
Q: Explain why it is possible for the proband in the following pedigree to have children of blood types…
A: A family may be a representation of our family tree. It appears how people inside a family are…
Q: how is the correct order to arrange the steps
A: Step1 position the unit away from heaters and atleast 12 inches away from wall. Step 2 Locate the…
Q: What do you mean by hominoid stock?
A: Animal diversity and origin are the natural history about the animal forms. In the animal diversity,…
Q: In the karyotype shown here, identify the sex chromosomes. Is this individual a male or a female?
A: Introduction Any cell contains a specific number of chromosomes referred to as ploidy level or…
Q: Is this karyotype male or female? Kind of error (if any) Name of Syndrome
A: INTRODUCTION: A karyotype is the number and appearance of the chromosomes in the nucleus of a…
Q: What letters are used to represent the short andlong arms of human chromosomes?
A: CHROMOSOMES These are thread-like structures located inside the nucleus of animal and plant cells.…
Q: What is the Characteristic pedigree for mitochondrial disease?
A: The genes located on the nuclear chromosomes obey the Mendelian law of inheritance. In the human…
Q: Why Geneticists Use a Variety of Symbols for Alleles ? What are those ?
A: A variable form of a gene is called an allele. Some genes exist in multiple versions, all of which…
Q: Rank the following base pairs according to their stability. Rank from most to least stable. To rank…
A: DNA is a double-stranded molecule made up of two polynucleotide strands arrange in helical form. The…
Q: Elements that have a: next to them mean that there are multiple types of that one element. When…
A: In chemical formulae, we use parentheses to form subgroups of atoms within a molecule.
Q: Why is a karyogram arranged from largest to smallest? What would happen if it was arranged from…
A: Karyogram is known as the arrangement of chromosomes which are in homologous pairs . The homologous…
Q: How do I construct these punnets squares?
A: Punnet square The Punnett square was first time designed by Reginald C. Punnett. It is use to…
Q: from the following matings? What are the phenotypic ratios for each cross? Explain how you came up…
A: Gregor Johann Mendel was an Augustinian monk. He worked on garden pea for the genetic experiment and…
Q: Where does the translocation occurs?
A: Answer: Introduction: Translocation is the process in plants that functions to transport the…
Step by step
Solved in 2 steps
- Drag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson archAvailable whis.picture. https://www.phys.ksu.edu/gene/photos/sd.html.g will help vou imagine the results for platehelp fill out the following illustration ..
- Question: Hi, can someone help me with this question thanks in advance. Select one of the following genetic diseases that appear in the following list:galactosemiacystic fibrosisDown's Syndromefamilial hypercholesterolemiamuscle gystrophyHuntington's diseasesickle cell anemiahemophiliaTay-Sachs diseasedescribe a composition about how the selected condition is generated. Include details about the number of people who report the disease, symptoms, treatments, among other aspects that you consider important. thanks15/doc.aspx?sourcedoc={dac0ebeb-b019-4578-911c-98.. Search (Option + Q) Review View Help Table O Editing er Av A =Final Assessment for Exploring M X forms/d/e/1FAIpQLSe8RrfvHEr59pISGjbEneL041GxKTvyw9-Xc_EA7Um_8xqReA/viewform?hr_submission-Chg1990yzQ8SEAjwvY285... First mRNA base (5) end of codon) A Sequence C Sequence D 5. A DNA sequence of "ACG" will code for the amino acid UUG CUC CUA CUG wh GUC GJA GUG Cys 100 AUU AUC lle ACC AUA ACA AUG MACG] Val M Second mRNA base UCA UCG The GCU GCC.. GCA GIGA CAA CAG Tyr UAC UGC UAA Stop UGA Stop A UAG Stop UGG Tro AAU AAC MT AAC GAC GAG 2 Lys Asp CGA CGG AGU AGC AGA AGG Lys GGU GGC GGA GGG Arg DUAU Gly C Third mRNA base (3' end of codon) Lys (K) DELL C GU A C DEOTOCCAGUCAGUCAGUCHOSOTOS M G (F) A (LS1-1) * GU A C CUGA OPCUGACU GACUSACCO AD A G OCO Trp (W) \u« 9799%3Fo 33 4Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11patibility Mode] UE Layout References Mailings Review View A A Aa vA 前、一间刷 一| T AaBbCcDdE AaBE x A Av X, Normal No Spacing Headi co Edit and Save Start your free one month trial of Microsoft 365 or sign in to activate an existing subscription. 9. In human beings, the gene for red-green colorblindness (r) is sex-linked and recessive to its allele for normal vision (R), while the gene for freckles (F) is autosomal and dominant over its allele for nonfreckled (f). A nonfreckled, normal-visioned woman whose father was freckled and colorblind, marries a freckled, colorblind man whose mother was nonfreckled. a. What is the genotype of the woman's father? b. What is the probability that the couple's first child will be a non-freckled, normal visioned girl c. What is the probability that the first two children born to the couple will be freckled and colorblind girls? d. What is the probability that the first child born to the couple will either be a freckled, colorblind boy or a non-freckled,…Search (Option + Q) rences Review View Help Editing v A^ Dv A A A Question 1 During nucleic acid hybridization, the probe is labelled for DNA stability to increase probe-test DNA binding to identify the location of probe and the test DNA binding for amplification Question 2 10 IV 12 13 14 Which of the following best describes the trait in the pedigree? Question 2 options: X-linked dominant X-linked recessive autosomal domiant autosomal recessiveNeed help answering these questions: Looking at the picture attached, Notice the indel symbol at location 296 of the query. What is the corresponding amino acid in the subject? How many nucleotides were inserted/deleted here?III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…SEE MORE QUESTIONS