Q: The data below represent a cohort of organism “X”, tracked from birth to death. Time period* Number…
A: A life table is a breakdown of a population's survival and reproduction rates by age, size, or…
Q: During the late phases (plateau) of the action potential of fast myocardium (e.g. ventricle) which…
A: Fast myocardium is a term used to describe the type of cardiac muscle that makes up the atria and…
Q: what is the cellular morphology and arrangement of bacillus subtilis and bacillus megaterium?
A: Biochemical tests coupled with results of Gram stain which reveals the organisms Gram reaction and…
Q: 3. How do vaccines work? bioquing so
A: Vaccines work by stimulating the bodies immune system to recognize & fight off specific viruses…
Q: Which of the following cloning strategy will be best to clone multiple DNA fragment (~10 fragments)…
A: Gibson assembly is a type of DNA assembly method that allows for the joining of multiple DNA…
Q: TATAAAA ↑ A > > > > > > > > +1 ↑ B Start codon 5'-UTR C 3'-UTR ↑ D ATG ←E Polyadenylation signal…
A: DNA acts as genetic material in almost all living organisms. DNA is a self replicating molecule.…
Q: . search for information and elaborate on rabbits about their Behavior and Habitat 2. please put…
A: Rabbits are interesting mammals that are widely distributed throughout the world. They have unique…
Q: Although numerous treatments are available for advanced hormone receptor- positive (HR+) and human…
A: Cancer is a group of diseases characterized by uncontrolled growth and spread of abnormal cells.…
Q: DNA sequences CGCCTAGTCA Strain 1 TCCCTACT CG Strain 2 ATCCTATAAC Strain 3. GACCTAAGCT Strain 4…
A: Classification is done on the basis of relatedness. This relatedness can be established by the…
Q: How can you dampen the frequency for bass reflex cabinet?
A: A bass reflex cabinet, also referred to as a ported cabinet or a vented cabinet, is a kind of…
Q: Water, water, everywhere: which type to drink? How might your choice of water be affected by this…
A: There are various types of water available on the market, including tap water, spring water,…
Q: What is the probability that their fourth child to have CF? • What is the probability that their…
A: The genetic disorder Cystic Fibrosis (CF) affects the respiratory, digestive, and reproductive…
Q: summarise the effects of cortisol and the tissues it acts upon.
A: Cortisol It is defined as a steroid hormone that is produced by our adrenal glands which are…
Q: 3. In 2015, the WHO surveyed 10,000 people on the subject of drug resistance. Seventy-five percent…
A: Treatment for infections brought on by bacteria resistant to antibiotics might be challenging or…
Q: sophagus: What type of tissue lines the esophagus? Why is this tissue well-suited for this location?
A: The oesophagus is a muscular tube connecting the mouth and the stomach. It is responsible for moving…
Q: Sharks live in marine (saltwater) habitats and are osmoconformers. Based on this information which…
A: This question relates to the osmoregulation abilities of sharks, which are marine osmoconformers.…
Q: What is the optimal growth conditions of FECAL coliforms in freshwater. Discuss it in detail (such…
A: Freshwater resources are critical to human survival, but they are also susceptible to contamination…
Q: The following features is(are) the requirement(s) for homologous recombination to occur: A) Very…
A: In living organisms, homologous recombination is a critical mechanism for maintaining genomic…
Q: Answer by listing only the name of the disease. Some questions will require the name of the…
A: A bacterial infection is an illness caused by the invasion and multiplication of harmful bacteria in…
Q: 6b. Which ions are pumped out of the cell by the Na/K* ATPase? 6c. Which ions are pumped into the…
A: ATPase pump also known as ATP powered pumps are a group of membrane proteins that use the energy…
Q: Give an example of an early experiment in signal transduction and the photoreceptor that is…
A: Photoreceptors are specialized cells or proteins that sense light. Signal transduction is the method…
Q: What are the 8 possible gamestes that can be formed from the following genotype. AaBBEeFf. List…
A: Gametes are cells that contain only one set of dissimilar chromosomes. As they contain half of the…
Q: Explain the activities associated with the isolation of Bacillus megaterium organsim from mixed…
A: Bacteria are single-celled microorganisms that are prokaryotic in nature, meaning they lack a…
Q: Which of the following best describes the impacts of antigenic variation? Mark all that apply. A.…
A: Genetic variation refers to the differences in the genetic makeup (DNA sequences) among individuals…
Q: 1-Individual 13 decides he wants children and marries a woman is not affect or a carrier for…
A: Pedigree analysis helps us to understand the mode of inheritance of a particular disease by…
Q: why when changing your diet, it's important to know how the cells in your body will react to the…
A: An extremely low-calorie diet (VLCD) is a diet that restricts daily calorie intake to between 500…
Q: if you didn't squeeze out all of the liquid from your casein would your calculation percent yield in…
A: Percent yield is a measure of the efficiency of a chemical reaction or process, which is calculated…
Q: Section 1: Matching restriction enzyme Barr body CCAAT box enhancer TATA-binding protein A. highly…
A: Restriction enzymes: Restriction enzymes are important tools in molecular biology that are used to…
Q: The toolkit genes generally regulate_____ [A]_____ in order to direct development. Other…
A: The Central Dogma of molecular biology is a framework that describes the flow of genetic information…
Q: Table 1- Comparison of the effect of catechol concentration on the amount of product formed.…
A: Enzymatic reactions refer to chemical reactions that are facilitated or catalyzed by enzymes.…
Q: Question 8 a) Explain what is meant by "somatic effects" of radiation exposure. b) Explain how the…
A: Somatic effects refer to the biological changes that occur in the cells or tissues of an individual…
Q: 2. While there are drugs available to treat viral infections, again, it is a very small number…
A: Viruses, which are teeny infectious agents that can reproduce themselves inside the cells of a host…
Q: what does it mean if my P value is P< .001 for average absorbance ratios of A260/A280 of dna…
A: In statistics, a P value is a measure of the strength of evidence against the null hypothesis. The…
Q: Answer by listing only the name of the disease. Some questions will require the name of the…
A: Enamel is the hard, outermost layer of the teeth that covers the visible portion of the tooth called…
Q: What type of signal sequence(s) would be used to create the ACE2 (type 1) integral membrane protein?
A: This question focuses on the type of signal sequences required to create a specific integral…
Q: Decide on two restriction sites that you can use to clone this into pL4440’s MCS. Identify their…
A: DNA cloning restriction sites are specific DNA sequences recognized and cleaved by restriction…
Q: Give typing answer with explanation and conclusion Dose-response relationship between number of…
A: A dose-response relationship is the relationship between the amount or dose of a substance,…
Q: 4. Three major activation pathways of the complement system. Bridging the innate vs adaptive…
A: The complement system is a complex system of proteins and enzymes that work together to help the…
Q: Describe two meals, one should include a combination of plant-based proteins and the second should…
A: Macronutrients are a class of nutrients that give your body the energy and components it needs to…
Q: Identify one mistake that was introduced in the following figure. True or false? The first few…
A: Since it is the method through which DNA is utilized as a template to produce RNA, transcription is…
Q: 4. Name and briefly describe the modes of action of the five major antimicrobial drug groups.
A: Antimicrobial drugs are substances that are used to treat or prevent infections caused by bacteria,…
Q: Bacteriophage A 200 μl of bacteriophage A was added to 800 μl of E. coli broth culture. The mixed…
A: The stepwise dilution of a solution to reduce its concentration is called serial dilution. In…
Q: Answer by listing only the name of the disease. Some questions will require the name of the…
A: Microorganisms like bacteria, viruses, parasites cause various diseases in our body. Some bacterial…
Q: What profession do you pursue or hope to pursue in the future? What is one physical activity that…
A: Physical activities are an important part of many jobs, and these activities necessitate the use of…
Q: 3) What is meant by the terms "delta variant" and "omicron BA.2" variants? How many waves of global…
A: The delta variant and omicron BA.2 variant are two strains of the SARS-CoV-2 virus, which causes…
Q: what is a sensory receptor and what is an example of one?
A: There are several places on the body where sensory receptors may too be found, including the skin,…
Q: Decide on two restriction sites that you can use to clone this into pL4440’s MCS. Identify their…
A: The recombinant DNA technology use plasmid to transfer foreign DNA into the host organism in which…
Q: Question 1 In the mid-1890s, the discovery of which of the following aroused great public excitement…
A: X-rays are a type of electromagnetic radiation with a wavelength shorter than that of ultraviolet…
Q: What did Galvani's first round of frog experiments demonstrate? A. Nervous tissue is reactive in the…
A: Galvanis experiments on frogs involved the observation of the muscular contractions in frog legs…
Q: You are a commercial developer, and you were asked to develop a golf course on what is presently…
A: Water quality refers to the chemical, physical and biological characteristics of water that…
Step by step
Solved in 3 steps
- b. Which one of the following a cell mutants will be able to switch at least once? [Select]Drag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson arch5'-TAGCTGATCGAATATGCGGTCTCTATCTTCGTAGACGA-3' 3'-ATCGACTAGCTTATACGCCAGAGATAGAAGCATCTGCT -5' Determine the amino acids that will be encoded by this sequence Second letter First letter U C A G U UUU Phe UUC UUA UUG Leu CUU CUC CUA CUG Leu GUU GUC GUA GUG Val UCU UCC UCA UCGJ AUU AUC lle AUA ACA AUG Met ACG CCU CCC C CCA CCG ACU ACC GCU GCC GCA GCG Ser - Pro Thr Ala A UGU UACTyr Cys UGC. UAA Stop UGA Stop A UAG Stop UGG Trp G CAC His CAA Gin CAG GAUT GAC Asp GAA AAU Asn ACC Ser AGU AAG LYS AA Glu GAGJ Oa. N-Met-Arg - Ser-Leu-Ser - Ser-C Ob. N-Met-Pro-Arg - Asn-Asp - Ser-C d. N-Met-Lys - Val-Glu-Ala-C Oc. N-Asp-Pro-Lys - Ser - Val-Ile-C Oe. N- Met-Ala-Asp-Pro-Lys - Ser-C G CGU CGC CGA CGG AGA AGG. GGU GGC GGA GGG Arg SCAO Gly U UCAG UUA DUAG Arg G Third letter 13
- Draw the peptide at a pH @1 of Cys-His-Glu-Met-Ile-Ser-Thr-Arg-TyrSecond letter A UUU UCU) UC UCA UCG UAU UUC Phe UUA Tyr UGU UGCJ Ser UAA Stop UGA Stop A UAG Stop UGG Trp UUG Leu CAUHIS CUU CUC CUA CUG CCU* C ССА CCG CGU His САС Leu CGC Arg CGA Pro CAA Gin CGGJ Gln Which amino acid is carried by the TRNA with the anticodon 5'-UCA-3? ACU ACC ACA AAU AAC. AGU AGC AGA AUU Ser Asn AUC Ile A AUA Thr AAA Lys AAG Lys AGG Arg AUG Met ACG GAU GGU] GUU GUC GUA GUGJ GCU GCC GCA GCG GAC Asp Ala GAA GGC Gly GGA Val GAG Glu GGGJ Isoleucine. None-this is a stop codon. Aspartic acid. Histidine. IV. Leucine O V. Third letter UCAG UCAG UCAG First letterposition position (5' end) position (3' end) UUU Phe - F UUC Phe UAU Tyr Y. UAC Tyr UAA Stop UGU Cys UGC Cys UGA Stop UGG Trp UCU Ser UCC Ser U UUA Leu UUG Leu UCA Ser UCG Ser UAG Stop W 輔 CAU His CGU Arg CGC Arg CGA Arg CGG Arg CUU Leu CCU Pro CUC Leu CCC Pro P. CCA Pro CÁC His CỦA Leu CAA Gln CUG Leu CCG Pro CAG GIn AUU lle ACU Thr AAU Asn AGU Ser AUC lle ACC Thr -T ACA Thr AAC Asn_ AGC Ser AGA Arg AGG Arg A AUA lle AAA Lys EK AAG Lys AUG Met ACG Thr GUU Val GGU Gly GGC Gly GGA Gly GGG Gly GAU Asp D GAC Asp GCU Ala GUC Val -V GUA Val GCC Ala GCA Ala GCG Ala G - A GAA Glu FE GAG Glu GUG Val Nonpolar Polar Basic Acidic Stop codon Table 4.1 Biology: How Life Works, Third Edition © 2019 W. H. Freeman and Company Consider the DNA sequence–3'-CACTGGTAGCGA–5', • What is the sequence of the messenger RNA sequence that is transcribed from this DNA sequence? (Indicate the 5' and 3' ends of the RNA molecule.) • Consult the genetic code that is shown above. What is the amino acid sequence of the…
- personal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc={a6b083c9-a226-4c31... O Search (Option + Q) Review View Help Editing v A BI U Ov =<=v 三 v ... Question 13 Zinc finger nuclease is a Gene editing tool: which uses a site-specific endonucleases containing a DNA-cleavage domain and a modular DNA-binding domain RNA-guided endonucleases programmable nucleases Exonuclease Question 14 Which elements are required for DNA to behave as a chromosome in yeast cells: a centromere an autonomous replicating sequence two telomeres Antibiotic selection marker Question 15 A series of such clones where the insert of each clone partially overlaps that of its neighbors with no gaps is known as a Clone Contig DNA fingerprinting A tiling path Genome MacBook ProBM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation LeadpleFinal Assessment for Exploring M X forms/d/e/1FAIpQLSe8RrfvHEr59pISGjbEneL041GxKTvyw9-Xc_EA7Um_8xqReA/viewform?hr_submission-Chg1990yzQ8SEAjwvY285... First mRNA base (5) end of codon) A Sequence C Sequence D 5. A DNA sequence of "ACG" will code for the amino acid UUG CUC CUA CUG wh GUC GJA GUG Cys 100 AUU AUC lle ACC AUA ACA AUG MACG] Val M Second mRNA base UCA UCG The GCU GCC.. GCA GIGA CAA CAG Tyr UAC UGC UAA Stop UGA Stop A UAG Stop UGG Tro AAU AAC MT AAC GAC GAG 2 Lys Asp CGA CGG AGU AGC AGA AGG Lys GGU GGC GGA GGG Arg DUAU Gly C Third mRNA base (3' end of codon) Lys (K) DELL C GU A C DEOTOCCAGUCAGUCAGUCHOSOTOS M G (F) A (LS1-1) * GU A C CUGA OPCUGACU GACUSACCO AD A G OCO Trp (W) \u« 9799%3Fo 33 4
- Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA1_30*_SP23 - General Biology I (for majors)/1 of us page The anticodon sequence created from the following DNA: TACGGGGCTGAGATT F1 Select one: O a. Tyr-Gly-Ala-Glu-lle O b. AUGCCCCGACUCUAA c. UACGGGGCUGAGAUU O d. Met-Pro-Arg-Leu-STOP F2 # 80 F3 $ 000 000 F4 % F5 MacBook Air F6 & r F7 DII F8Genetic Code-Reference Second Letter First Letter C Third Letter UAU] UACS **UAA Stop UGU] Cys UGC U UUU Phe UUC UCU Туг UCC U Ser UUA) Leu UUG **UGA Stop UGG Trp UCA UCG **UAG Stop CUU CCU CAU) CGU His CACJ CAA) CUC CCC CGC Leu Pro Arg CUA ССА CGA A Gln CUG CCG CAGJ CGG AAU] AGUSer U AUU ACU AACAsn AAA Lys AUC Ile ACC AGC C Thr AGA] Arg AUA ACА AAGJLYS GAU] GACASP *AUG Met/Start ACG AGG U GUU GCU GGU Asp GUC GCC GGC Val Ala Gly GAA) Glu GAGJ GUA GCA GGA GUG GCG GGG